PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK27808.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family bZIP
Protein Properties Length: 160aa    MW: 17753.8 Da    PI: 10.3309
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK27808.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.22.3e-1578139162
                 XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                 +ke kr +r+ +NR++A+  R+RKk ++  Le+kvkeLe++N++L ++l++l++e + l++ 
  KFK27808.1  78 DKENKRLKRLLRNRVSAQQARERKKVYLTDLEKKVKELENKNSQLEERLSTLQNENQMLRQI 139
                 5899*****************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR000412.1E-57793IPR001630cAMP response element binding (CREB) protein
SMARTSM003383.4E-1478142IPR004827Basic-leucine zipper domain
PfamPF001701.6E-1379140IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.74880143IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.3E-1782142No hitNo description
SuperFamilySSF579591.94E-1382140No hitNo description
CDDcd147042.71E-1583134No hitNo description
PROSITE patternPS00036085100IPR004827Basic-leucine zipper domain
PRINTSPR000412.1E-595115IPR001630cAMP response element binding (CREB) protein
PRINTSPR000412.1E-5115132IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MQEQATSSLA ASSLPSSSER SSSSAPPLEI KEGMESDEEI RRVPEFGGEI TGIVNSGQEQ  60
GQATVGERQR KRGRNVADKE NKRLKRLLRN RVSAQQARER KKVYLTDLEK KVKELENKNS  120
QLEERLSTLQ NENQMLRQIL KNTTANKRGG GSGGGSNPEC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2oqq_A9e-15104142442Transcription factor HY5
2oqq_B9e-15104142442Transcription factor HY5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006394793.15e-73hypothetical protein EUTSA_v10004860mg
SwissprotO246464e-66HY5_ARATH; Transcription factor HY5
TrEMBLA0A087GD561e-110A0A087GD56_ARAAL; Uncharacterized protein
STRINGscaffold_601144.11e-65(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56912749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.12e-44bZIP family protein